NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029591

3300029591: Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Thr2 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300029591 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116197 | Gp0321340 | Ga0307353
Sample NameMetatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Thr2 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23672283
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381
Not Available4
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActive Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations
TypeEngineered
TaxonomyEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025291Metagenome / Metatranscriptome202N
F028541Metagenome / Metatranscriptome191Y
F056712Metagenome / Metatranscriptome137N
F059033Metagenome / Metatranscriptome134N
F070165Metagenome / Metatranscriptome123N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307353_107062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038802Open in IMG/M
Ga0307353_107519Not Available774Open in IMG/M
Ga0307353_107696Not Available764Open in IMG/M
Ga0307353_109101Not Available695Open in IMG/M
Ga0307353_110473Not Available640Open in IMG/M
Ga0307353_115949All Organisms → cellular organisms → Bacteria507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307353_107062Ga0307353_1070621F028541EQQGAFMNERERLKLINRLKTARTSEERDQILWYLAGQDKAARGKAQRAEPTGTGKPAPGSVPEKHPLGLPGGKLGGMGSITSLLFLFYGLVTIAAAAAKIVQGQMEGDEIKQLIMGGIFLVVGVVLFVKAKRAQRKAAEEA
Ga0307353_107519Ga0307353_1075191F070165MVRMRRRGRNARRSTQTLTHTAVFTMGGPTSVSASNLGLIGIATVSPARPCRPVNVKLTVVSGAPHIIRFAAYAGGKEEIFSSAPFAVGLAPRVLNFRLPKSTDFSLYSASGSTVFTFQPMSDLNVSVKVGVLATFEYKYPTGALPDYEPALILTH
Ga0307353_107696Ga0307353_1076961F025291NLRKEINIFRDRAWRVITYNYHLGDHSSTGLYTLNVGADQRYMTFQTLLTTDEFQNMAVVYNEFKIHKAVFTSLPTSNSNRLPYLYVDIEPSTSAGVNPNNVRVCADDSARIFAPKALQPQSCEWNLQGIGPNFNMWLDTGATIPGQFQIGNYIFGSIPISLGWEVKFQLVVEFTNPK
Ga0307353_109101Ga0307353_1091011F070165LGSLTGFQVPANPSNSKKITMVRMRRRGRNARRATQTLTHTAVFTMGGPTSVSASNLGLIGIATVSPARPCRPVHVKLTVVSGAPHIIRFAAYAGGKEEIFSSAPFAVGLAPRVLSFRLPRSTDFSLYSAPGSTVFTFQPMSGLDVSVKVGCLTTFEYKYPTGAHGDLRYEPAVIEVV
Ga0307353_110473Ga0307353_1104731F059033LAAAWDVGTEFEPIVIDMLRISSFLRTAVTAKASHGIKHEYRFFKSLPLAVFREIGEGIVPQKIGPDKAQIDLKELVFDLYEDYQGILQYPGGKEGWLKDYYPIALMALTNAITQSSFYGNIPGFGYEKAFKGFHQYAKDLGQVVAQKGGSSGSCSSIFAVRWEKFDGASLRFNNTELLNVIDMTPNQPIPIVTDTTTNKQMNIFKWIFSSYF
Ga0307353_115949Ga0307353_1159492F056712AGLVGILEGLEKSLVRRLMKSSGKQPFLIVFLILFLSMNKKGKKKIEPEKDENYWRVIGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.