NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029547

3300029547: Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35551



Overview

Basic Information
IMG/M Taxon OID3300029547 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133139 | Gp0283744 | Ga0245108
Sample NameHuman fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35551
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size127984887
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUnited Kingdom: London
CoordinatesLat. (o)51.5Long. (o)-0.12Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084124Metagenome112Y
F105374Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0245108_100011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii370040Open in IMG/M
Ga0245108_100207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes92667Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0245108_100011Ga0245108_100011356F084124LNTTALAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNKLSFSTQTAWLFAPDKLLYLKIFMGAAQTRNF
Ga0245108_100207Ga0245108_10020743F105374MKKRVALLVALCIWKVVAAQTPYGEMPERFWPDTLPCRLGGGVCFGMNGLDAAIPRGGRASSCRDPRVVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.