| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029547 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133139 | Gp0283744 | Ga0245108 |
| Sample Name | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35551 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 127984887 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | United Kingdom: London | |||||||
| Coordinates | Lat. (o) | 51.5 | Long. (o) | -0.12 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084124 | Metagenome | 112 | Y |
| F105374 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0245108_100011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 370040 | Open in IMG/M |
| Ga0245108_100207 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 92667 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0245108_100011 | Ga0245108_100011356 | F084124 | LNTTALAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNKLSFSTQTAWLFAPDKLLYLKIFMGAAQTRNF |
| Ga0245108_100207 | Ga0245108_10020743 | F105374 | MKKRVALLVALCIWKVVAAQTPYGEMPERFWPDTLPCRLGGGVCFGMNGLDAAIPRGGRASSCRDPRVVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP |
| ⦗Top⦘ |