3300029538: Human fecal microbial communities from Shanghai, China - P021V6

Overview

Basic Information

• IMG/M Taxon OID: 3300029538
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133133 | Gp0283523 | Ga0244900
• Sample Name: Human fecal microbial communities from Shanghai, China - P021V6
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 151197425
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Shanghai, China
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: China: Shanghai
• Coordinates
  • Lat. (^o): 31.2112312
  • Long. (^o): 121.4647709
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078693	Metagenome	116	N
F089005	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0244900_101466	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii	15787
Ga0244900_124176	Not Available	643

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0244900_101466	Ga0244900_1014661	F089005	LTKSKQRSIIALALLRLATSNEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMYTKKHH
Ga0244900_124176	Ga0244900_1241761	F078693	APVRGAERSCIKADCSLLMSKENQKTTSDFDALDPRERGCSPLSDPKGEVETEKS