| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029538 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133133 | Gp0283523 | Ga0244900 |
| Sample Name | Human fecal microbial communities from Shanghai, China - P021V6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 151197425 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078693 | Metagenome | 116 | N |
| F089005 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244900_101466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 15787 | Open in IMG/M |
| Ga0244900_124176 | Not Available | 643 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244900_101466 | Ga0244900_1014661 | F089005 | LTKSKQRSIIALALLRLATSNEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMYTKKHH |
| Ga0244900_124176 | Ga0244900_1241761 | F078693 | APVRGAERSCIKADCSLLMSKENQKTTSDFDALDPRERGCSPLSDPKGEVETEKS |
| ⦗Top⦘ |