3300029534: Human fecal microbial communities from Shanghai, China - P093V1

Overview

Basic Information

• IMG/M Taxon OID: 3300029534
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133133 | Gp0283628 | Ga0245005
• Sample Name: Human fecal microbial communities from Shanghai, China - P093V1
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 96068237
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Shanghai, China
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: China: Shanghai
• Coordinates
  • Lat. (^o): 31.2112312
  • Long. (^o): 121.4647709
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054110	Metagenome	140	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0245005_100731	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella	28616

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0245005_100731	Ga0245005_10073113	F054110	MNGRRYVVDTRQSWSKYDKPCKVYIVSRMYNEEEYKLTFPEKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVKTYKGGE