NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029527

3300029527: Human fecal microbial communities from Shanghai, China - P042V6



Overview

Basic Information
IMG/M Taxon OID3300029527 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133133 | Gp0283561 | Ga0244938
Sample NameHuman fecal microbial communities from Shanghai, China - P042V6
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size96782128
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Shanghai, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationChina: Shanghai
CoordinatesLat. (o)31.2112312Long. (o)121.4647709Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078693Metagenome116N
F105374Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0244938_100527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes36600Open in IMG/M
Ga0244938_105142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii2036Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0244938_100527Ga0244938_1005273F105374MKKRVTLQVALCIWKVVAAQTPYGEMPERFRPDTLPCRLGGGVCFGMDGLDAAIPRGGGASSCRDPRVVFVAGDTLITFISVAGVADTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVVRSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP
Ga0244938_105142Ga0244938_1051424F078693MVLAPVRGAERFFIKANCSLLMSKENQKSTSDFDALDPRERGCSPLSDPKGVVETEKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.