| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029526 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133133 | Gp0283574 | Ga0244951 |
| Sample Name | Human fecal microbial communities from Shanghai, China - P051V1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 59256829 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F062845 | Metagenome | 130 | N |
| F099269 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244951_100026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 148711 | Open in IMG/M |
| Ga0244951_100315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella | 25639 | Open in IMG/M |
| Ga0244951_102786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 2723 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244951_100026 | Ga0244951_1000268 | F047125 | MDIVLLLMVLGVMLSGFWAADALDHMRKEILRQEGKRRGWWS |
| Ga0244951_100315 | Ga0244951_10031529 | F099269 | VHGVLLSVQAGELLLLDDLGDRASGASVLASATGDAGVLVSDGGDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVD |
| Ga0244951_102786 | Ga0244951_1027862 | F062845 | MKKTPFILHEKFRSDNNEQRKERFQKEFERYIINGLLNAVPSRACT |
| ⦗Top⦘ |