| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029473 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283299 | Ga0244122 |
| Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001877-24 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 132967361 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F052660 | Metagenome | 142 | N |
| F067720 | Metagenome | 125 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244122_100362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 52446 | Open in IMG/M |
| Ga0244122_100912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 22614 | Open in IMG/M |
| Ga0244122_110746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1747 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244122_100362 | Ga0244122_10036241 | F026489 | MRSAGKVLLAEGCSLLVAKENQKSASDFDALEPRKRGYSPLLTPKRRATPEKTEDSRLFGVKIF |
| Ga0244122_100912 | Ga0244122_10091223 | F052660 | MRILRVLPENTPEKIGQERAGTEWTVVKSKIRLCIRNRSCGRFLHGGILMGIALPIPSHRAKSHDFAHWWPATAGHSRSADALPGKSNS |
| Ga0244122_110746 | Ga0244122_1107463 | F067720 | MASTTYRHLGDVTGMFAAQEQFRDITKMVTKRHQFAVLGNMVRNAGQLPQPFWLGAARGGGSCSAARCAART |
| ⦗Top⦘ |