3300029468: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001965-95

Overview

Basic Information

• IMG/M Taxon OID: 3300029468
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133130 | Gp0283384 | Ga0244207
• Sample Name: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001965-95
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118842701
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Shanghai Jiao Tong University, China
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: China: Shanghai
• Coordinates
  • Lat. (^o): 31.2123446
  • Long. (^o): 121.4684853
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0244207_123182	Not Available	530

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0244207_123182	Ga0244207_1231821	F055775	MAQIAQQDNLVIEVTTTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSGAVEAIALN