NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029460

3300029460: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001895-57



Overview

Basic Information
IMG/M Taxon OID3300029460 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133130 | Gp0283315 | Ga0244138
Sample NameHuman fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001895-57
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size125255333
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Shanghai Jiao Tong University, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationChina: Shanghai
CoordinatesLat. (o)31.2123446Long. (o)121.4684853Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056682Metagenome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0244138_100924Not Available22190Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0244138_100924Ga0244138_1009244F056682MKMQSRAEKVANQPIGQDKMHPASFGTFPSKNRSTFPIQELRKNREDQEVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.