NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029447

3300029447: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 075_4_28_stool_1



Overview

Basic Information
IMG/M Taxon OID3300029447 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133117 | Gp0283060 | Ga0243899
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 075_4_28_stool_1
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size302823872
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
Not Available1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044555Metagenome / Metatranscriptome154N
F055715Metagenome138N
F089005Metagenome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243899_1034314All Organisms → Viruses → Predicted Viral1332Open in IMG/M
Ga0243899_1044951Not Available1032Open in IMG/M
Ga0243899_1063146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus747Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243899_1034314Ga0243899_10343143F044555MKTTNPSSRITISQNGNQILTCKVYKEPNYILSMSNEEILELISGLDYMGNIPTVPNLEKPIEIQVSTIRQIPLEQNKEVQTKIKEIIYNNLYDTLVDELKGTISRFQAQYNIQEINPYLQDILQNPEDLVSLSQHHKR
Ga0243899_1044951Ga0243899_10449511F055715LTKSNEFDKINELLIERTAKKFERASKNKLKKFLTNEKFCDKINELIRVGTAEILDN
Ga0243899_1063146Ga0243899_10631461F089005LTKSKQRSIITLALLRLATSNEESKQALKVRRTLKIEQRDNSKETRNDFEGSSKNYSEMYTKKHHKLRI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.