| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029436 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133117 | Gp0282994 | Ga0243833 |
| Sample Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 048_3_10_stool_1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 239244350 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F029444 | Metagenome | 188 | Y |
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F047126 | Metagenome | 150 | N |
| F081354 | Metagenome | 114 | Y |
| F087336 | Metagenome | 110 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243833_1004732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 8413 | Open in IMG/M |
| Ga0243833_1007456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 5332 | Open in IMG/M |
| Ga0243833_1025366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1446 | Open in IMG/M |
| Ga0243833_1025667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1428 | Open in IMG/M |
| Ga0243833_1042199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 841 | Open in IMG/M |
| Ga0243833_1047209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae | 750 | Open in IMG/M |
| Ga0243833_1048352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 732 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243833_1004732 | Ga0243833_10047322 | F081354 | LVCENQQSSAHNFVKDFSSIFLKSSRRSPLKKGAVATIPLEYGKAEVQTLFEPLQATISSMELPKNFENKKLPNTLRRLAFLPFHL |
| Ga0243833_1007456 | Ga0243833_10074563 | F081354 | LVRENQQSSAHNFVKDFSLIFLKFSRLCPLKKGAATENPLEYGKTEVQILFEPLQAAISSMELPKNFENKKLPNPLR |
| Ga0243833_1025366 | Ga0243833_10253662 | F047125 | MDVVLLLMVLGVMLSGFWAADALDHLRKEIIRQEGKRRGWWS |
| Ga0243833_1025667 | Ga0243833_10256672 | F026489 | LVAKENQKTTSDFDALEPRKRGCSPLLTPKKWAAPKKTEDSCLFGVKVF |
| Ga0243833_1042199 | Ga0243833_10421992 | F047126 | MTNISQTQAGFKSKSLGILCGFQGFLTQNPAALVETDDIFDVSDTPYGFSGLNTLRAAGVPNPLPPFAQRFIACFCSQTAAASQSKSAYILSSLESPCILCSLLR |
| Ga0243833_1047209 | Ga0243833_10472092 | F087336 | MVAELEQVPKAFRAADNQRRAAAKERIKDDAIGHGRVSDRILAEIEDNHMRERDTKIGLAEQRQVAFLGIAFQILP |
| Ga0243833_1048352 | Ga0243833_10483522 | F029444 | MEVSEQLTGFEPEDLMSWTVSNLRRPFREDFSLEKSGIIAEKGAQIFGRRFVGFDGPKKAAPFFNF |
| ⦗Top⦘ |