NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029382

3300029382: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 075_4_29_stool_1



Overview

Basic Information
IMG/M Taxon OID3300029382 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133117 | Gp0283062 | Ga0243901
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 075_4_29_stool_1
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size313819163
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F042910Metagenome157N
F099269Metagenome103N
F101357Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243901_1027265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella1963Open in IMG/M
Ga0243901_1046855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1194Open in IMG/M
Ga0243901_1098156All Organisms → cellular organisms → Bacteria616Open in IMG/M
Ga0243901_1114922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales534Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243901_1027265Ga0243901_10272651F099269VHGVLLSVQVGELLLFDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGS
Ga0243901_1046855Ga0243901_10468554F101357QYEQWQNTGSVNLMQKESHMLSKVWLKTNIYNPDSLDKPFIQLSATFTSEFDIQEYNEWLNANQYKLYPLLLDILKISLKDDFYNYSNTSNIHYEGGKFPSMLTIQLFNLEF
Ga0243901_1098156Ga0243901_10981561F032312SLKRKTMARIKDYDEDLSAPKLLRERARDSKGRFIKKDLPPYLGSEQVLKPKNYYHFDSHGNYKGSSMNFDALVCLGFTWFKLLGVALMMLLWPIVFIYALHDGIEGYPFKKYAIPYIFILVAWFIIFLYGLVS
Ga0243901_1114922Ga0243901_11149221F042910EQLSLRVRFLIEEYDIAARHQLLHLVAAWAEAGGVLTLHEDGKRVLRVVCTQYPTMSTLNWLETLSLVFTAFSCPYWEDAAETSFLMPNTSDAPSKLLAVPGDAPETPLNLLIRNIGDAAITTLTISAAGKISFQGLTLAPGAAIRIHHDAGVFAAEMVSDDSTVSILPYRTPDSAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.