| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029324 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133112 | Gp0282355 | Ga0243218 |
| Sample Name | Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-49_Run5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Zhejiang University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 118312419 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Hangzhou | |||||||
| Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052660 | Metagenome | 142 | N |
| F062845 | Metagenome | 130 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243218_100222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 46334 | Open in IMG/M |
| Ga0243218_100729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 19742 | Open in IMG/M |
| Ga0243218_101727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 9256 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243218_100222 | Ga0243218_10022231 | F062845 | MKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLNAVPPRACA |
| Ga0243218_100729 | Ga0243218_1007291 | F052660 | MCILRVLPENTPEKIGQERAGTEWTVVKSKISLCIRNRSYGQFLHGGILMGIALPIPSHRAKSHDFAHWWPAAAGHSR |
| Ga0243218_101727 | Ga0243218_1017274 | F052660 | MCILRVLPEKTSERIGQERAGTEWTVVKSKIRLCIRNRSYRRFFYGGILMGIVLPIPSHRAKSHDFAHWWPAAAGHSRSADALPGKSNF |
| ⦗Top⦘ |