Basic Information | |
---|---|
IMG/M Taxon OID | 3300029324 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133112 | Gp0282355 | Ga0243218 |
Sample Name | Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-49_Run5 |
Sequencing Status | Permanent Draft |
Sequencing Center | Zhejiang University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 118312419 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Hangzhou | |||||||
Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052660 | Metagenome | 142 | N |
F062845 | Metagenome | 130 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0243218_100222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 46334 | Open in IMG/M |
Ga0243218_100729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 19742 | Open in IMG/M |
Ga0243218_101727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 9256 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0243218_100222 | Ga0243218_10022231 | F062845 | MKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLNAVPPRACA |
Ga0243218_100729 | Ga0243218_1007291 | F052660 | MCILRVLPENTPEKIGQERAGTEWTVVKSKISLCIRNRSYGQFLHGGILMGIALPIPSHRAKSHDFAHWWPAAAGHSR |
Ga0243218_101727 | Ga0243218_1017274 | F052660 | MCILRVLPEKTSERIGQERAGTEWTVVKSKIRLCIRNRSYRRFFYGGILMGIVLPIPSHRAKSHDFAHWWPAAAGHSRSADALPGKSNF |
⦗Top⦘ |