| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029186 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127425 | Gp0193162 | Ga0167509 |
| Sample Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021587-57 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 91364404 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Beijing, Peking Union Medical College | |||||||
| Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059106 | Metagenome | 134 | N |
| F084124 | Metagenome | 112 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0167509_100783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 23806 | Open in IMG/M |
| Ga0167509_100830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae | 22198 | Open in IMG/M |
| Ga0167509_103309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 2937 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0167509_100783 | Ga0167509_1007837 | F084124 | LNITALAFARATKENTLPLHGQRNELTVFLAFPVTMAIACFNKLSFNTQTTTLFAPEELLYRMIFMGAAQTRKPLKRLDLNFLII |
| Ga0167509_100830 | Ga0167509_10083016 | F059106 | ILLQTFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV |
| Ga0167509_103309 | Ga0167509_1033094 | F084124 | VWAKPTNTFHLCNLTIAKQAKAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNKLSFSTQTAWLFAPKKLLYRKILWALPKPAIFEKIE |
| ⦗Top⦘ |