3300029149: Marine sediment microbial communities from University of Hong Kong - Deep-ocean Sediment

Overview

Basic Information

• IMG/M Taxon OID: 3300029149
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118575 | Gp0137341 | Ga0119977
• Sample Name: Marine sediment microbial communities from University of Hong Kong - Deep-ocean Sediment
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hong Kong
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 6443113
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep-Ocean Sediment → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → deep marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009040	Metagenome / Metatranscriptome	324	Y
F095628	Metagenome	105	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119977_100101	Not Available	1327
Ga0119977_101035	All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Pyrococcus → Pyrococcus horikoshii → Pyrococcus horikoshii OT3	725

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119977_100101	Ga0119977_1001011	F009040	SGADPKLPQAAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEASKAD
Ga0119977_101035	Ga0119977_1010351	F095628	VYMYLRDFCFCIRNPSAALAMKYGSEPFYDSWASSYAYKMRI