| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029147 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118575 | Gp0137467 | Ga0120079 |
| Sample Name | Estuary sediment microbial communities from University of Hong Kong - Estuary Sediment |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hong Kong |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 4702194 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Estuary Sediment → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | estuarine biome → estuary → sediment |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000918 | Metagenome / Metatranscriptome | 834 | Y |
| F016968 | Metagenome / Metatranscriptome | 243 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120079_100027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1368 | Open in IMG/M |
| Ga0120079_101080 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120079_100027 | Ga0120079_1000271 | F016968 | SKALIALVGLVCITILLGLNRIPTEAGTGMIGTILGYAVGNGIAAKQGKEVSPIIGAKK |
| Ga0120079_101080 | Ga0120079_1010802 | F000918 | MYKTNQQAWKEVMQSFKEDERQTAICQKMYGQDNLIGLTEEQKQAFWKAI |
| ⦗Top⦘ |