NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029145

3300029145: Aquariaum water viral communities from Chicago, USA - Stingray Touch - STA1



Overview

Basic Information
IMG/M Taxon OID3300029145 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127413 | Gp0192425 | Ga0168039
Sample NameAquariaum water viral communities from Chicago, USA - Stingray Touch - STA1
Sequencing StatusPermanent Draft
Sequencing CenterMichigan State University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7373646
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquariaum Water Viral Communities From Chicago, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: Chicago
CoordinatesLat. (o)41.87Long. (o)-87.61Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006550Metagenome / Metatranscriptome370N
F050009Metagenome146N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0168039_10642All Organisms → Viruses → Predicted Viral1747Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0168039_10324Ga0168039_103249F050009KAMREPYLLFNFEDKLVKVADKITNFDNLKRYEIKNPDLLWIDKYGMWIIEVDGAVHDRKVEKTKKRNALFLKNHIKLIVVNLADIKELGHNIYEYIDSQILERIRE
Ga0168039_10642Ga0168039_106421F006550MARIFNEKKADYKGMQLWLNPADESVYATERAPTHSFAEAGGYAIYDFKKHFANKEAGKDSMGSNQYMHDAFVDPEFKATAEDYIADIKAGGRQRTAALRSFTNSAVDIVNVWETVLGKQDRTYAGKNLAKEIAVPNLLISIDTATKFGGMTQLDEGQLGQLKELTYSRQNFEANKYGLKFVIHEEARLKNVHNVLQDSIQVASNKIEQKQSFDVIAAANSGLTAKAAVGVWDTFVASTDRSTNSPLIDLGIVKLLIEGSGVGGRMNRVGMHPLDFAKYMSNTFVRGVASTKPSEVTFEPGTRELPGFPEAGLVLDNTITQGEAYCVDTEKELLEKWAERDRDWE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.