Basic Information | |
---|---|
IMG/M Taxon OID | 3300029083 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193534 | Ga0169225 |
Sample Name | Human fecal microbial communities from infant at 12 months in Denmark - 181_12M |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 53618331 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Denmark | |||||||
Coordinates | Lat. (o) | 55.676097 | Long. (o) | 12.568337 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F068811 | Metagenome | 124 | N |
F084124 | Metagenome | 112 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0169225_100278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 30387 | Open in IMG/M |
Ga0169225_102208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2975 | Open in IMG/M |
Ga0169225_103976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1808 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0169225_100278 | Ga0169225_10027812 | F084124 | LNITALAFARATKENTLPFHGQRNELTVFLAFPVTMAIACFNKLSFSTQTTTLFAPEELLYRMIFMGAAQTRKPLKKLDLNFLII |
Ga0169225_102208 | Ga0169225_1022084 | F026592 | ILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQLFSADRE |
Ga0169225_103976 | Ga0169225_1039763 | F068811 | MDQDGSEHNICSNREGLCPGKKQHGASGWKKIFQHGKEPLRNKDSVSQYCNKKAAVLLILNENVSETLCIFSIDKTNCCRI |
⦗Top⦘ |