| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029049 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193687 | Ga0169693 |
| Sample Name | Human fecal microbial communities from mother in Denmark - 38_M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 142930351 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Denmark | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F055715 | Metagenome | 138 | N |
| F099269 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0169693_105676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 4309 | Open in IMG/M |
| Ga0169693_106861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3665 | Open in IMG/M |
| Ga0169693_109299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens | 2812 | Open in IMG/M |
| Ga0169693_109654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2714 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0169693_105676 | Ga0169693_1056761 | F055715 | LTKANEFDKINELLIERTAKKFEKASKNKLKKFLTNERLCDKINELIRVGTAKILDN |
| Ga0169693_106861 | Ga0169693_1068614 | F055715 | LTKANEFDRINELLIERTAENKTFSGSSKELQKNKLKKFLTNEKLCDKINELIRVGTAEILD |
| Ga0169693_109299 | Ga0169693_1092992 | F099269 | VHGVLLNVQVGELLLLDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCAPV |
| Ga0169693_109654 | Ga0169693_1096542 | F047125 | MDVALLLMVLGVMLSGFRAADALDHIRQEILRQEGKRRGWWS |
| ⦗Top⦘ |