| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029030 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193667 | Ga0169673 |
| Sample Name | Human fecal microbial communities from mother in Denmark - 367_M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 120591751 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 8 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-28 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Denmark | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F054110 | Metagenome | 140 | N |
| F055715 | Metagenome | 138 | N |
| F067844 | Metagenome | 125 | N |
| F076064 | Metagenome | 118 | N |
| F090515 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0169673_100930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 14326 | Open in IMG/M |
| Ga0169673_101357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii | 10319 | Open in IMG/M |
| Ga0169673_102962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 5197 | Open in IMG/M |
| Ga0169673_113310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-28 | 1505 | Open in IMG/M |
| Ga0169673_117626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1197 | Open in IMG/M |
| Ga0169673_135584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 658 | Open in IMG/M |
| Ga0169673_140376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 592 | Open in IMG/M |
| Ga0169673_149425 | Not Available | 500 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0169673_100930 | Ga0169673_1009302 | F055715 | LTKANEFDKINELLIERTAKKFERASKNKLKKFLTNEKFCDKINELIRVGTAEILDN |
| Ga0169673_101357 | Ga0169673_1013573 | F076064 | LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNEAKRPPKPALKFY |
| Ga0169673_102962 | Ga0169673_1029621 | F026592 | SPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0169673_113310 | Ga0169673_1133103 | F026592 | SPQGIAALAAQGGVATLTERSDATFFVGQFSSADRE |
| Ga0169673_117626 | Ga0169673_1176263 | F067844 | MNTLAAETASAWYLILNRKRPPKRAVASYFNMTQFSSHLPRPLTMGTQQVSAGAA |
| Ga0169673_135584 | Ga0169673_1355842 | F054110 | VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVKTYKGGD |
| Ga0169673_140376 | Ga0169673_1403762 | F047125 | MDVALLLMVLGVMLSGFRAADALDYMRKEILRQEGKRRGWWS |
| Ga0169673_149425 | Ga0169673_1494251 | F090515 | VTTCCKAGPKAALQGTAPGRVACLEFAGGEKRKTNIAADYAVKALTFTALLCRHIGSIRTFLKS |
| ⦗Top⦘ |