NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029028

3300029028: Human fecal microbial communities from infant at 12 months in Denmark - 350_12M



Overview

Basic Information
IMG/M Taxon OID3300029028 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127429 | Gp0193660 | Ga0169666
Sample NameHuman fecal microbial communities from infant at 12 months in Denmark - 350_12M
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size93506945
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes timonensis1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationDenmark
CoordinatesLat. (o)55.678Long. (o)12.531Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076064Metagenome118N
F092228Metagenome107N
F105374Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0169666_100618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii33822Open in IMG/M
Ga0169666_101371All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes timonensis13082Open in IMG/M
Ga0169666_101640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii10045Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0169666_100618Ga0169666_10061831F092228MKKKCTLVLISVLTVACIVFAYLLFFYNPSFNMVYDSDTDSYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVKLPSNGCLINDNLFYINGNKLCCLDTTTNTRKTIDTDCRSFVCNNEVIAYTKNDSVILKNSDTLENIGDIKFDNQIYYINISDGNLYIAERIFEDKTDEYGYSFKVGKQYIFKKYDLKSCKLLKSKNANYVNGIRYVTVCQDTFYFFCDETQTVNNVCLDKDVNYPTIQHPDVKFITSNNDCVYYISEKTESAIIRKTVESPYNGIWKLEVGSNKHAKIADKCDCDELLATKNFLYCYTINYILPRGVANSWVKGYLIDQLAIS
Ga0169666_101371Ga0169666_1013717F105374MKKRVVLLVALCIWKVVAAQTPYGEMPERFRPDTLPCRLGGGVCFGMDGLDAAIPRGGGASSCRDPRGVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP
Ga0169666_101640Ga0169666_1016405F076064LKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEVYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRYPMPVLKLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.