Basic Information | |
---|---|
IMG/M Taxon OID | 3300029020 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193696 | Ga0169702 |
Sample Name | Human fecal microbial communities from infant at 12 months in Denmark - 42_12M |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 94450628 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 3 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Denmark | |||||||
Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092227 | Metagenome | 107 | N |
F097172 | Metagenome / Metatranscriptome | 104 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0169702_100268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 42596 | Open in IMG/M |
Ga0169702_106158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2389 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0169702_100268 | Ga0169702_1002685 | F097172 | MKKNVFKKLMCAVLATACVATAVVPAMADDVITAEAATKKVTSAYKYHLEGYDKNGYPVSGFSKTSFYKDLNSLPAVKTGKTTINVPAVTSSVKSVSKEKGNPEYESYVKFKAQKTGKYVFTIDNLQGTDDKSLKCLNIYICRIAKNGKKYFLEDDLYPDTVGNYGDLYENNYLARLRTILDNYKEEHPEYADVIEETYEYQKDFVNKYPVAKDKFTTKLKKGQTYVFVIDNRGMQKAVPPYFTTHGSDEQSCLWGGNYLKAYSFDMNIEYRK |
Ga0169702_100268 | Ga0169702_1002687 | F097172 | MKKNVLKKLMCAVLAAACVATAVVPAMADDVVTAEAATKKVTSAYKYHLEGCDKKGYVMDGFSKAAFYKDLNSLPAVKIGKTTINVPAVTSSVKSISKEKGNPIYESFVKFKAPKTGKYVFTLDNLQGTDDKSLKCMADGDLCQISKTGKKYGLDGVEDSDTVGKYDTLYENNYLARLRTILDNYKAEHPEYADVIEYDYNDYTDFVNKRPVDKIKFTTRLKKGHTYVFVIDNALGRTTCKPYFTTHGSDEQSCLYNTNYLAAYSFDMNIEYRK |
Ga0169702_106158 | Ga0169702_1061583 | F092227 | MNEQKRKRILRVGCLILAGVFLLSVMGSVILMFLV |
⦗Top⦘ |