NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029020

3300029020: Human fecal microbial communities from infant at 12 months in Denmark - 42_12M



Overview

Basic Information
IMG/M Taxon OID3300029020 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127429 | Gp0193696 | Ga0169702
Sample NameHuman fecal microbial communities from infant at 12 months in Denmark - 42_12M
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size94450628
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationDenmark
CoordinatesLat. (o)55.678Long. (o)12.531Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092227Metagenome107N
F097172Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0169702_100268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis42596Open in IMG/M
Ga0169702_106158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii2389Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0169702_100268Ga0169702_1002685F097172MKKNVFKKLMCAVLATACVATAVVPAMADDVITAEAATKKVTSAYKYHLEGYDKNGYPVSGFSKTSFYKDLNSLPAVKTGKTTINVPAVTSSVKSVSKEKGNPEYESYVKFKAQKTGKYVFTIDNLQGTDDKSLKCLNIYICRIAKNGKKYFLEDDLYPDTVGNYGDLYENNYLARLRTILDNYKEEHPEYADVIEETYEYQKDFVNKYPVAKDKFTTKLKKGQTYVFVIDNRGMQKAVPPYFTTHGSDEQSCLWGGNYLKAYSFDMNIEYRK
Ga0169702_100268Ga0169702_1002687F097172MKKNVLKKLMCAVLAAACVATAVVPAMADDVVTAEAATKKVTSAYKYHLEGCDKKGYVMDGFSKAAFYKDLNSLPAVKIGKTTINVPAVTSSVKSISKEKGNPIYESFVKFKAPKTGKYVFTLDNLQGTDDKSLKCMADGDLCQISKTGKKYGLDGVEDSDTVGKYDTLYENNYLARLRTILDNYKAEHPEYADVIEYDYNDYTDFVNKRPVDKIKFTTRLKKGHTYVFVIDNALGRTTCKPYFTTHGSDEQSCLYNTNYLAAYSFDMNIEYRK
Ga0169702_106158Ga0169702_1061583F092227MNEQKRKRILRVGCLILAGVFLLSVMGSVILMFLV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.