3300028983: Human fecal microbial communities from infant at 12 months in Denmark - 274_12M

Overview

Basic Information

• IMG/M Taxon OID: 3300028983
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127429 | Gp0193612 | Ga0169618
• Sample Name: Human fecal microbial communities from infant at 12 months in Denmark - 274_12M
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 40478492
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N
F089005	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0169618_101270	All Organisms → cellular organisms → Bacteria	3086
Ga0169618_101412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	2720

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169618_101270	Ga0169618_1012703	F089005	LTKSKQCSIIALALLRLATSNEESKQALKVRRTLKIEQRENSKETRNDFEESSKNYSEMYTKKHQE
Ga0169618_101412	Ga0169618_1014123	F047125	MDVVLLLMVLGVMLSGFWAADALDHMRKEILQQEXXXXXXWS