3300028441: Soil microbial communities from Anza Borrego Desert, Southern California, United States - Bradyrhizobium sp. S3-V5C

Overview

Basic Information

• IMG/M Taxon OID: 3300028441
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128792 | Gp0307459 | Ga0268288
• Sample Name: Soil microbial communities from Anza Borrego Desert, Southern California, United States - Bradyrhizobium sp. S3-V5C
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 21570657
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): desert biome → desert → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 33.305
  • Long. (^o): -116.2548
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022481	Metagenome / Metatranscriptome	214	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0268288_10161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4840

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0268288_10161	Ga0268288_101617	F022481	MTPGRTTRFKNATEPFFARFFIDFIPGLAAEFAFTEGSTRVIMSLSAALWMDRKQIDGWRFQHGCSTGRHALRLSFWQLGHLSA