 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028387 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133461 | Gp0215346 | Ga0264391 |
| Sample Name | ANME aggregate JGI 7061.QLV.BNCT.01.D9_combo |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 4354812 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sediment Cell Enrichment Communities From Methane Seep In Santa Monica Basin, California, United States |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Sediment Cell Enrichment Communities From Methane Seep In Santa Monica Basin, California, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 33.0 | Long. (o) | -118.0 | Alt. (m) | N/A | Depth (m) | 860 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052687 | Metagenome | 142 | Y |
| F066277 | Metagenome | 127 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0264391_10255 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 4397 | Open in IMG/M |
| Ga0264391_10710 | All Organisms → cellular organisms → Bacteria → FCB group | 1780 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0264391_10255 | Ga0264391_102552 | F066277 | MDRKKFVALFSTSLLGAALLKANPFNFFAPKSNSKGSNSVKVKINPNAVNREKSGKKNG |
| Ga0264391_10710 | Ga0264391_107102 | F052687 | VTRFLTILLLLAAVGGGLYYLLTRETVEDIKVTDKLQISQQIGNYVKASQADDEDYFAVVEGKIKNNLGKPIKNVFIKYMIAGQETSATVFDVAPGQEIHFNTRGVNTSAPNPEYDFVGIYYD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |