NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028264

3300028264: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0666-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028264 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296269 | Ga0256893
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0666-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size188516404
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Clavicipitaceae → Claviceps → Claviceps purpurea → Claviceps purpurea 20.11
Not Available1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032070Metagenome / Metatranscriptome181Y
F071833Metagenome / Metatranscriptome121Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256893_1038773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Clavicipitaceae → Claviceps → Claviceps purpurea → Claviceps purpurea 20.11035Open in IMG/M
Ga0256893_1063148Not Available759Open in IMG/M
Ga0256893_1080612All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff646Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256893_1038773Ga0256893_10387731F032070SAVPAYTGAPDFGLIHINPEETAKAFQAYLDTASKLTGVSLDDIRTTVSALPQNQERVTLTELLSLGMKLFDAIVWLTAGRPKSHPLSIDPSLTKDKIPSMHEVARSVFYCYFMLVTQARYPVGRNETEKPRIPNFLKTIMGMEKEQHVYVDVICSFSPQKFDPAWAKYVSFANFGQEVLSRFGLGVAGYRMFGPFGLYNPKPDMDPELKPAFEFARTVAKAPSSWNVHPLTRNPNILTARGNLNKNLNNLLLDAFTQADLEEMERAKVIYKIPTREPAHRQYRQWTSNDDITGSALIFR
Ga0256893_1063148Ga0256893_10631481F071833IMNFSSEFTQDPQQNINLVQILIKRKLIEPFEKLSRESVECYNLQKGTKEANNEYATRVNKCLDSWQKHFESVEDHTNKYLSNLRAKEALHFSKLFHCSNAINDKDVEACRKEENHRFATELKETFSQL
Ga0256893_1080612Ga0256893_10806121F098404TVMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWFHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEIIHDVKKPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGSQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.