NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028249

3300028249: Metatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.0 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028249 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132855 | Gp0267201 | Ga0232079
Sample NameMetatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.0 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size40946204
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0382
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa
TypeEngineered
TaxonomyEngineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: New York
CoordinatesLat. (o)42.4447Long. (o)-76.485Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028541Metagenome / Metatranscriptome191Y
F039694Metagenome / Metatranscriptome163Y
F041848Metagenome / Metatranscriptome159N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0232079_108267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381169Open in IMG/M
Ga0232079_114175Not Available774Open in IMG/M
Ga0232079_122484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038539Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0232079_108267Ga0232079_1082671F039694LADTGRQREIRGGRQADMESNIVDTMRRYFQNDTGKTKGDLEYTILNSVKRYFEGKPPEKLR
Ga0232079_114175Ga0232079_1141751F041848AKQYSTALAAKGALLVSIVSVAHSFVHLRIGAVGAKNLEVERLNLGEFVQFEGADGALYEVRLLAVEGFDTATMMVTRIR
Ga0232079_122484Ga0232079_1224841F028541QILWYLAGQDKAARGKAQRAEPTGTGKPARGKTEEKPRVSLPVGKLGGVVSFTALLFLFYGLVSIVTAVMKILQGQMEGDEIKQLIMGGLFLLFGVVIYVRARRAQRKTAEET

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.