NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028170

3300028170: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0744-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028170 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296282 | Ga0256906
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0744-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size250325932
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Pseudocohnilembidae → Pseudocohnilembus → Pseudocohnilembus persalinus1
Not Available2
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002654Metagenome / Metatranscriptome539Y
F028371Metagenome / Metatranscriptome191Y
F057456Metagenome / Metatranscriptome136N
F071833Metagenome / Metatranscriptome121Y
F075510Metagenome / Metatranscriptome118N
F096377Metagenome / Metatranscriptome104Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256906_1000939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea8935Open in IMG/M
Ga0256906_1016159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Pseudocohnilembidae → Pseudocohnilembus → Pseudocohnilembus persalinus2182Open in IMG/M
Ga0256906_1020071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1945Open in IMG/M
Ga0256906_1072610Not Available880Open in IMG/M
Ga0256906_1086514All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff772Open in IMG/M
Ga0256906_1106808Not Available661Open in IMG/M
Ga0256906_1141159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata535Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256906_1000939Ga0256906_10009395F075510VYXXIFTDKNLNTDTLIRLAYGHYVSAFYMAYLGLLHGIDMHYDXKNEATYDGLEPEMSWXDEALSNELGTFIEALIVLNIICWXLYPEPEALSYEIFMXGDIGLISDVRFYGVAPHXYFRPFMAWLIVCPHHKTGIFGLIFLFFSLFHQPTLHGVNESGFFYKRRLLFTINRVKQKNFYKQSHLNLEMNLFFQTTYALFIMCALYTNTFLPYGRFYNRLGGNIGMLSAYFYVFLYLGITSLRRPYWLELYFYFIYNRTNFLKKNLVFLPKINFYK
Ga0256906_1016159Ga0256906_10161592F057456VIPSVAFPIIQDLPFKDLVILRSAYATVRFVDNQTVRQDLAVELFK
Ga0256906_1020071Ga0256906_10200711F096377KHATNIFTTSLLNLIYRWKSFNVTHHKVAGKDRKYLKINNNSDLVQFQSKYKSTPLYFIPTDDNNVNIFITDNDAIINDILGQEDIIEDVVSKLFAKLDRNPTPFQEDLWLPIFSIKEKTIDLEAAKTLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPNEKSKIIEKPFLFGILHEQVDFPLFAVVVKPEDFAQHE
Ga0256906_1072610Ga0256906_10726101F028371VVVDESFLVSASEDGLDVSGLLDFSSTFNDLLLGEFNTVVLEVPLSERSSIDLDDTALDQSVGSDEFVVGGVVDDTDDLGLSGDLFRSPGEVSGVESEGLEFVVSSSNSVSSDGLFTDLGESGRTTRFVLLLLLVDGHPTTGKSSLVSRVSGDTHYV
Ga0256906_1086514Ga0256906_10865141F098404VPFQSLDFTHTAMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKSPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGPK
Ga0256906_1106808Ga0256906_11068081F071833NNPTKKTMNLSSDYTQDPQQNINLVQILIKRKLIEPFEKLSKENVECYNLERGTLEGKPQYFERVNKCLDSWQRHFERVESNTNQYLSKLREKEASHFSKLFHCSNAINDPEIQACRKEENERFANELKDTFSQL
Ga0256906_1141159Ga0256906_11411591F002654DKVVCQKGNSPEQVFKVPKFLLSESKEVFKLYNQEIGLEAVIF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.