NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028164

3300028164: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0668-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028164 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296271 | Ga0256895
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0668-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size167507740
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F047414Metagenome / Metatranscriptome149Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256895_1065078Not Available722Open in IMG/M
Ga0256895_1073976All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff655Open in IMG/M
Ga0256895_1076416Not Available640Open in IMG/M
Ga0256895_1085327All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff589Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256895_1065078Ga0256895_10650781F005470SLPTSNMSVKVRKEGQVITEFPKEMVPRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKVREFLAKFEKGLHKMPKKPLLIFVTYNDWLDNNFDENTREWLEEFLKPKSFYELVELFNAAFYLQIDDLREISAARIAHSIILERKAPEDFLRDFGIATQYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256895_1073976Ga0256895_10739761F098404TAMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHVGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPDILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPKECHLGPK
Ga0256895_1076416Ga0256895_10764161F047414RMHRDSLMLSPLFSSNTHNGGFFSGFTPRYFSNVPHMQDTSKTFGPDDFLLRPSPTHMDIDVNARFEKAVENMKMELRNNPAQHLGDHGMDQQGLNLDIDLIDDSYLHAPLTKSPHLQFVGGSQPTSKCSFKKFGEWTLSPNASFLPRKKF
Ga0256895_1085327Ga0256895_10853271F098404IMRSALFFVVLAVAIACAAAAVRPKLSETFESNGFVSIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGFDHLNVYELQRFDKGKAYEVIHDEKKPICHTKSLTGKMPQLWDWVEKADFVRNFTSSGTLYDLWSYKTAGITLEVGVPQAHPDILAYFGRFSAGNEFSYFVETWKNIKPHSTWFEIPRECHLGPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.