NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028116

3300028116: Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028116 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133460 | Gp0293484 | Ga0255291
Sample NameMetatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5165638
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomeriverriver water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Louisiana
CoordinatesLat. (o)29.8571Long. (o)-89.9778Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004323Metagenome / Metatranscriptome443Y
F042867Metagenome / Metatranscriptome157Y
F089936Metagenome / Metatranscriptome108Y
F099393Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0255291_100985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
Ga0255291_101150Not Available751Open in IMG/M
Ga0255291_101155Not Available749Open in IMG/M
Ga0255291_101476Not Available677Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0255291_100985Ga0255291_1009851F004323MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSGVFQAAALRLF
Ga0255291_101150Ga0255291_1011501F089936NRKAYFMKKALIGMAVGAMALGASVVPASAGYLGSSDDLTLWDGIAGTDGGSTDAPQGPEALCNDGQDDIFEALVLTGGWASRLDTDGNGKPRYTVFQPYDLILNGLLGALGLEISDLNSQPAVVQGILADHIANGSFDENELEDTDLTRITMRSGFVATLTESEYDVMFPPAATFGERDMYENVYIEGVKIEDGGQYANGWLYCIGGIIDSTPQVSHEGLNSEDTPNDGTPGGTNSLPDTL
Ga0255291_101155Ga0255291_1011551F099393QRERETLMLVERGMPKRRFFPHGETQAPDSACGQVTRSGLVASRVRKVVFFSVCLPALLIALGAGDSLSLAYGQSESNAAVPTAVRATESGLSDQNRPTRDRSEPTVTGAAMHVALFVPR
Ga0255291_101476Ga0255291_1014762F042867DVAPRQVVTPLAVVHTGVACAAVGIDTTVIESSDETATSVKERLNLKVLMSYLVILSLALPDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.