| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027328 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0099546 | Gp0055083 | Ga0209020 |
| Sample Name | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by bead beating (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 296225412 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gulf of Piran, Adriatic Sea | |||||||
| Coordinates | Lat. (o) | 45.5099 | Long. (o) | 13.56 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030180 | Metagenome / Metatranscriptome | 186 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209020_1093958 | Not Available | 541 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209020_1093958 | Ga0209020_10939581 | F030180 | FRPFDMLSVPNQSLVVLENDNHRIGAECVVGVQDSFHRYVDCDMVYFQFCGNTTVETEFGVYVMEPGEVMLVPGGISHRSIGRNDSLRYFCLNREAVDYVLDEEKYTSHQSFVMTRHNGPNWSGLEAPTGDVKGQVTEKMHFWDDSPDDLTVVERDYDSLVGVSTLKPKQQESGIRKLR |
| ⦗Top⦘ |