3300027328: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by bead beating (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300027328
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0099546 | Gp0055083 | Ga0209020
• Sample Name: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by bead beating (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 296225412
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea
• Type: Host-Associated
• Taxonomy: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Gulf of Piran, Adriatic Sea
• Coordinates
  • Lat. (^o): 45.5099
  • Long. (^o): 13.56
  • Alt. (m): N/A
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030180	Metagenome / Metatranscriptome	186	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209020_1093958	Not Available	541

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209020_1093958	Ga0209020_10939581	F030180	FRPFDMLSVPNQSLVVLENDNHRIGAECVVGVQDSFHRYVDCDMVYFQFCGNTTVETEFGVYVMEPGEVMLVPGGISHRSIGRNDSLRYFCLNREAVDYVLDEEKYTSHQSFVMTRHNGPNWSGLEAPTGDVKGQVTEKMHFWDDSPDDLTVVERDYDSLVGVSTLKPKQQESGIRKLR