3300027276: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - LMS_cellobiose_enrichment (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300027276
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114675 | Gp0119870 | Ga0208297
• Sample Name: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - LMS_cellobiose_enrichment (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 288227685
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Ohio
• Coordinates
  • Lat. (^o): 40.178
  • Long. (^o): -81.073
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208297_1035462	Not Available	986

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208297_1035462	Ga0208297_10354623	F029444	MEVSEQLTGFEPEDLMPWTVSNLQRPFREDFSLEKSGIIAEKESQILGCRFVGFDEPKKAAPFFNF