3300027113: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0686-MT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300027113
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114432 | Gp0296274 | Ga0256898
• Sample Name: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0686-MT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 222716175
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005470	Metagenome / Metatranscriptome	399	Y
F009305	Metagenome / Metatranscriptome	319	Y
F098404	Metagenome / Metatranscriptome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256898_1065364	Not Available	809
Ga0256898_1088034	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	661
Ga0256898_1091996	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff	642

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256898_1065364	Ga0256898_10653641	F005470	YQISISANMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256898_1088034	Ga0256898_10880341	F009305	LIRLAYGHYVSAFYMAYLGLLHGIDMHYDXKNEATYDGLEPEMSWXDEALSNELGTFIEALIVLNIICWXLYPEPEALSYEIFMXGDIGLISDVRFYGVAPHXYFRPFMAWLIVCPHHKTGIFGLIFLFFSLFHQPTLHGVNESGFFYKRRLLFTINRVKQKNFYKQSHLNLEMNLFFQTTYALFIMCALYTNTFLPYGRFYNRLGGNIGMLSAYFYVF
Ga0256898_1091996	Ga0256898_10919961	F098404	SIFRLTHTVMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWFHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEIIHDVKKPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGPKETC