3300027086: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0493-MT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300027086
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114432 | Gp0296261 | Ga0256885
• Sample Name: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0493-MT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 189864525
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098404	Metagenome / Metatranscriptome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256885_1090654	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff	583
Ga0256885_1093477	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff	570

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256885_1090654	Ga0256885_10906541	F098404	RSALFFVVLAVAVACAAAAVRPKLSETFESNGFVSIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGFDHLNVYELQRFDKGKAYEVIHDEKKPICHTKSLTGKMPQLWDWVEKADFVRNFTSAGTLYDLWSYKTAGITLEVGVPQAHPDILAYFGRFSAGNEFSYYVETWKNIKPHSTWFEIPRECHLGPK
Ga0256885_1093477	Ga0256885_10934771	F098404	RSFLICVVLALAIACAAAQQTRPKLSETFESKGFVQIKNNGTLFFGEGWFHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPDILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECH