Basic Information | |
---|---|
IMG/M Taxon OID | 3300027082 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053056 | Gp0053347 | Ga0207414 |
Sample Name | Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 1 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 197884011 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → pond → sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Alviso Ponds, San Francisco, CA, USA | |||||||
Coordinates | Lat. (o) | 37.475383 | Long. (o) | -121.9729 | Alt. (m) | N/A | Depth (m) | .09 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033443 | Metagenome / Metatranscriptome | 177 | Y |
F078533 | Metagenome / Metatranscriptome | 116 | Y |
F098766 | Metagenome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0207414_1041600 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria | 967 | Open in IMG/M |
Ga0207414_1048669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
Ga0207414_1089936 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 539 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0207414_1041600 | Ga0207414_10416002 | F098766 | MSHPTCSICGREADGANHVRVEVARVPPEEPPKTYYFHPWCFENAQSWERGV |
Ga0207414_1048669 | Ga0207414_10486693 | F078533 | MTPAEFKAARNALCLSQRDLAEVWGMGQNGERTIRRWEQGDVPVNPIAAYCIRLMDEQAR |
Ga0207414_1089936 | Ga0207414_10899361 | F033443 | EHKLLYELKNLYNVLNSKNQGELYRQPINVLLETINLQTDQDRMSKVLNELSVYDWVPEIKLFVHNLTTSPEKKANLLSGGQAESVYTIVEQVEEGHIAHIKDSWFLLKEDSVEKALLEEHIKDENELRKLRMIESAMKYAQIEDDRINFRISENLTIGLGVDNKAIYINDDELNEEST |
⦗Top⦘ |