3300026917: Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN103 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026917
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053063 | Gp0054856 | Ga0208065
• Sample Name: Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN103 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 18482697
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	1
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → land → fertilized soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Browns Valley, California, USA
• Coordinates
  • Lat. (^o): 39.23550963
  • Long. (^o): -121.2836963
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016792	Metagenome / Metatranscriptome	244	Y
F041998	Metagenome / Metatranscriptome	159	Y
F100860	Metagenome	102	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208065_100793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM	868
Ga0208065_101942	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	646
Ga0208065_103091	All Organisms → cellular organisms → Bacteria	548

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208065_100793	Ga0208065_1007932	F016792	QRSPTVVPVCGLSWPRPGSRSPRSSTGSVRPEGCRGPHHPVDPQGSMREYPVREPCPPKCCYPDMRRSNPTCEALGTTATIWEHQSGGGLAEDEWLNASERPWLRSVIENRPKVLTGRSQKGTRVGSSAASTDDGGTKARRTIGRNLPIRLSTLDNRVSPIRPTVATRWYPDRKEGHGGGGRGTAEQAKAAL
Ga0208065_101942	Ga0208065_1019421	F100860	LSVYSFLGERLFQTTVPAPTNEYVWDLTAGGGTRRLVNGAYIVVVEVAGQRYRRRLFVARPSP
Ga0208065_103091	Ga0208065_1030911	F041998	RVLVDVRLIHIDHEMPIALSAGQNLLELLDKGLPPLRVGPAEQLLGLLPRQLAAVQDRADRLATAPQPKALADPMDEAAQGPARGWISPFEGWGGRRALGGADHRAEFGFAARAKKGRRPPVRRNVSASGPPWL