| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026914 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0054527 | Ga0208705 |
| Sample Name | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN94 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 11918430 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → land → fertilized soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Browns Valley, California, USA | |||||||
| Coordinates | Lat. (o) | 39.23550963 | Long. (o) | -121.2836963 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005849 | Metagenome | 388 | Y |
| F018431 | Metagenome | 235 | Y |
| F103766 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208705_100175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 998 | Open in IMG/M |
| Ga0208705_100225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 945 | Open in IMG/M |
| Ga0208705_100552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 724 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208705_100175 | Ga0208705_1001751 | F103766 | ARLDGLRSRGILSPNDDMIVTWKRSWLPNLMRSELGHWMLDNNLMEYYSETMIKDLRDAAAPAAASATPQPSPQMGAH |
| Ga0208705_100225 | Ga0208705_1002251 | F005849 | AGKPELLKLLTKDTNDIALIQTNAQAKLDNVKEDLKVLLEPKDPSAKVRTEAFMKDVAERIYIINAERDEVADVGPNGEKIVSETLRTVSELPTLGPPRLVTLRYDDIGGPEEDLRAKKSGVRDPIYAHRILVKMGEQKDFSFFDRFEQLLFDRIGVPPRNLSANVEQIRQSTFDRINSTIFEMNRFVVDRNPMVGLCWRNIADAVKAKLQNVPESQRQKETEDLVRQIYYVYIVLDQYAQLDELRSRGYVSGNDDKIIEWKRSMLPNLMRSDVGKWMLDSNLTEYYSEAMVRDLREAAGEKALSITPQADTR |
| Ga0208705_100552 | Ga0208705_1005522 | F018431 | MKTILSALVAFALLTLVGPTIQAAEKSKDTKTPKSGESFSGSGTVIKNNVDICLVTGLRWAIHPENGEDVKVYPKSKQATEVLDRAAKNKSKVRVAGTW |
| ⦗Top⦘ |