3300026678: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN620 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026678
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053063 | Gp0054520 | Ga0208711
• Sample Name: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN620 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3605433
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → fertilized soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Gorham, Kansas, USA
• Coordinates
  • Lat. (^o): 39.05
  • Long. (^o): -99.1
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003951	Metagenome / Metatranscriptome	460	Y
F009289	Metagenome / Metatranscriptome	320	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208711_100114	Not Available	924
Ga0208711_100663	Not Available	523

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208711_100114	Ga0208711_1001141	F009289	MSEPQPADELSPTDRELLRRAELALTQLNNRHGLETDQSATLTAIRLRLEGKSRASLDDLLVAGRDLGDKDPLSEAMTRRQQGPSFDDLVAGAERKPKKSLDDLL
Ga0208711_100663	Ga0208711_1006632	F003951	MGTDDSSTATPTLQREVCDKCGSRMELESSAYGFERWKCPKCQQIVGIDRDPEVGSRFQIARGQPWNYSPDAFKN