| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026644 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0055316 | Ga0208352 |
| Sample Name | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1118 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3312861 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. A3M-1-15 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | grassland biome → land → fertilized soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Nunn, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 40.81667 | Long. (o) | -104.76667 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001472 | Metagenome / Metatranscriptome | 688 | Y |
| F013569 | Metagenome / Metatranscriptome | 270 | Y |
| F018073 | Metagenome / Metatranscriptome | 237 | Y |
| F028934 | Metagenome / Metatranscriptome | 190 | Y |
| F033496 | Metagenome / Metatranscriptome | 177 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208352_100307 | Not Available | 621 | Open in IMG/M |
| Ga0208352_100336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. A3M-1-15 | 606 | Open in IMG/M |
| Ga0208352_100515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| Ga0208352_100526 | Not Available | 524 | Open in IMG/M |
| Ga0208352_100540 | Not Available | 518 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208352_100307 | Ga0208352_1003071 | F001472 | AIPRGGSLMRYKVGAEQLQQVPTFVHRPDTAFRASRVAPAGPTHAVCTRTGQTACGITAEGLAVLDQDWEEAFFVEKCPGCFAAVLADASDS |
| Ga0208352_100336 | Ga0208352_1003361 | F028934 | LIIHLIIQTILLYPSGAVWTDDAAHVSRLDPSGADQIDAEHQATD |
| Ga0208352_100515 | Ga0208352_1005152 | F018073 | MRRGGSLLITILLLVAAFWAGIQYERNNCRIDLPNSTNQVDQSVKCRDYKGVDLPG |
| Ga0208352_100526 | Ga0208352_1005262 | F033496 | VSGSDGSLPQDEGVADPAGEVEAALAGLDERDPAEHADLFEAVNAAILAELRRLEAL |
| Ga0208352_100540 | Ga0208352_1005401 | F013569 | MKEKKLTLSKETLRTLDEKELSQIVGGDQSGSHTPPQAGPNSCPNTKPHGCS |
| ⦗Top⦘ |