Basic Information | |
---|---|
IMG/M Taxon OID | 3300026644 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0055316 | Ga0208352 |
Sample Name | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1118 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 3312861 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 3 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. A3M-1-15 | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | grassland biome → land → fertilized soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Nunn, Colorado, USA | |||||||
Coordinates | Lat. (o) | 40.81667 | Long. (o) | -104.76667 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001472 | Metagenome / Metatranscriptome | 688 | Y |
F013569 | Metagenome / Metatranscriptome | 270 | Y |
F018073 | Metagenome / Metatranscriptome | 237 | Y |
F028934 | Metagenome / Metatranscriptome | 190 | Y |
F033496 | Metagenome / Metatranscriptome | 177 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208352_100307 | Not Available | 621 | Open in IMG/M |
Ga0208352_100336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. A3M-1-15 | 606 | Open in IMG/M |
Ga0208352_100515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
Ga0208352_100526 | Not Available | 524 | Open in IMG/M |
Ga0208352_100540 | Not Available | 518 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208352_100307 | Ga0208352_1003071 | F001472 | AIPRGGSLMRYKVGAEQLQQVPTFVHRPDTAFRASRVAPAGPTHAVCTRTGQTACGITAEGLAVLDQDWEEAFFVEKCPGCFAAVLADASDS |
Ga0208352_100336 | Ga0208352_1003361 | F028934 | LIIHLIIQTILLYPSGAVWTDDAAHVSRLDPSGADQIDAEHQATD |
Ga0208352_100515 | Ga0208352_1005152 | F018073 | MRRGGSLLITILLLVAAFWAGIQYERNNCRIDLPNSTNQVDQSVKCRDYKGVDLPG |
Ga0208352_100526 | Ga0208352_1005262 | F033496 | VSGSDGSLPQDEGVADPAGEVEAALAGLDERDPAEHADLFEAVNAAILAELRRLEAL |
Ga0208352_100540 | Ga0208352_1005401 | F013569 | MKEKKLTLSKETLRTLDEKELSQIVGGDQSGSHTPPQAGPNSCPNTKPHGCS |
⦗Top⦘ |