3300026639: Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1104 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026639
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053063 | Gp0055377 | Ga0208351
• Sample Name: Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1104 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3019424
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → fertilized soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Nunn, Colorado, USA
• Coordinates
  • Lat. (^o): 40.81667
  • Long. (^o): -104.76667
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009289	Metagenome / Metatranscriptome	320	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208351_10324	Not Available	565

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208351_10324	Ga0208351_103242	F009289	MPEPNEDLSPTDRELLRRAELALTQLNNRHGLEPDQSATLTAIRLRLEGKSRASLDDLLTAGKDLGGKDPLTEAMARGQQGPSFDDLVAGAEQKPKKSLDDLL