NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026628

3300026628: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_22 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026628 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114675 | Gp0119855 | Ga0208296
Sample NameDeep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_22 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size27062018
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zoneoil field production water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087432Metagenome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208296_100045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes52240Open in IMG/M
Ga0208296_103177Not Available1343Open in IMG/M
Ga0208296_104657Not Available926Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208296_100045Ga0208296_10004584F087432MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDRLTNLNFEQITFSAEQDARLQEISELNIPQGFQAEVREYVENGNFPEWYEHPLSDLKLKKERLQHQNDIDEAYQMILESEGLI
Ga0208296_103177Ga0208296_1031773F087432MIIYENGEYTPCTYRVTLQNKGVEETHYANFRTYWEDMVAKHEYLTNLSFEEITFSAEQDARLQEISELNIPQGFQAEVKEYVENGNFPEGLNNPLAGLKYKKEMNDAYKMILESEGLI
Ga0208296_104657Ga0208296_1046573F087432GEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLSFEEVSFSAEQDARLQEISELNIPQGFQAEVREYVENGNFPEGYEHPLSDLKLAKEREKYNEEINDAYKMILQSEGLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.