3300026519: Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 354-166

Overview

Basic Information

• IMG/M Taxon OID: 3300026519
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046784 | Gp0296304 | Ga0256839
• Sample Name: Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 354-166
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 577576218
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → rock
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Atlantic Ocean: Mid Atlantic Ridge
• Coordinates
  • Lat. (^o): 36.2297
  • Long. (^o): -33.9011
  • Alt. (m): N/A
  • Depth (m): 2262

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071990	Metagenome / Metatranscriptome	121	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256839_1114428	Not Available	901

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256839_1114428	Ga0256839_11144282	F071990	MAVPTTRFRVIPNSTATTAVDTPAKRLGIISGESLVSTGAGNEADLGTVNISAGAANSAVIHMLWDVTADGGNTLVDTFKLWLSANGFDVAASVLRFAAISGADQTIPTNTQNYVANATTASYTFADMPETEPASQNVYPSDEGTSMALATTSDDAIMWAV