x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300026441
3300026441: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0930-MT (Metagenome Metatranscriptome)
Overview
Basic Information
IMG/M Taxon OID 3300026441 Open in IMG/M GOLD Reference Gs0114432 | Gp0296228 | Ga0256779 Sample Name Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0930-MT (Metagenome Metatranscriptome) Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? N Use Policy Open
Dataset Contents
Total Genome Size 171037993 Sequencing Scaffolds 3 Novel Protein Genes 3 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria 1 All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff 2
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling Type Environmental Taxonomy Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
Alternative Ecosystem Assignments
Environment Ontology (ENVO) terrestrial biome → research facility → soil Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
Location Information
Location USA: Iowa Coordinates Lat. (o ) 42.0 Long. (o ) -93.0 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F041209 Metagenome / Metatranscriptome 160 Y F098404 Metagenome / Metatranscriptome 103 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0256779_1059884 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria 762 Open in IMG/M Ga0256779_1079211 All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff 618 Open in IMG/M Ga0256779_1081913 All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff 602 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0256779_1059884 Ga0256779_10598841 F041209 RTAAEMSPALCDQIAALRRKLQKGATARILFLDETALRLSAAPTHTIVLPGEQPYVLATDTSSYAARYDMIAVCSGVETLLPKVFTPAERKGADVRGVNSAMLLQFIDDTLAQAVEGLDRYPLVLVLDQATIHKNVEAIRQAFHDRGSQAIKDILFMPPNAAKRMSPLDNALFHDWKELCRKRCPVTKQTIQQVMADAWNKLPARLLHAHYKNCGLVRGQDPYFDCPDPAGHQHDS Ga0256779_1079211 Ga0256779_10792111 F098404 HIMRSALFFVVLAVAVACAAAAVRPKLSETFESNGFVSIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGFDHLNVYELQRFDKGKAYEVIHDEKKPICHTKSLTGKMPQLWDWVEKADFVRNFTSAGTLYDLWSYKTAGITLEVGVPQAHPDILAYFGRFSAGNEFSYFVETWKNIKPHSTWFEIPRECHLGPK Ga0256779_1081913 Ga0256779_10819132 F098404 SETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHVAKDKTPVCHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPNILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPKECHLGPK
