NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026438

3300026438: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0921-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026438 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296219 | Ga0256770
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0921-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size148651129
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041209Metagenome / Metatranscriptome160Y
F051903Metagenome / Metatranscriptome143Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256770_1041228Not Available900Open in IMG/M
Ga0256770_1055444All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria737Open in IMG/M
Ga0256770_1064226All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff667Open in IMG/M
Ga0256770_1067806All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff642Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256770_1041228Ga0256770_10412281F051903MCEQIAKVRRKLQRIGMQHILFLDETHKREGDVQGYTIVLPGEPPYIETSCTSSYAKRFDMIACCSGTTTLPPIIYSPDERKKGVNRAMLLSYINDLLAQAAGALDVYPLILLVDKATIHTEAEMLQEFHDNGCQDLTEVIRIPTASAKRLSPLDNSLFNVWRQRVLDGGPLTLDNIKRRMSAAWESITKADIHAQYKHCGLIRGSDVYFDCPNPTQHRHGR
Ga0256770_1055444Ga0256770_10554441F041209LLFLNETALRLSAAPSHTIVLPGEQAYVLATETSAYAKRYDMIAVCAGDRVLLPKIFSPKERAGAEVKGINRSMLLQFIDDVLAQAVEGLDRYPLTLVLDRATIHMDLDAIRQAFRDRGSEAISDILLMPPNAAKRLSPLDNSLFHDWKEECRRHCPATAKTIERIMSDAWEKLKPGPHYLHCGLTRSKDVYFDCPAPAKHKHAS
Ga0256770_1064226Ga0256770_10642261F098404LHFTHTAMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGSQ
Ga0256770_1067806Ga0256770_10678061F098404QHIMRSALFFVVLAVAIACAAAAVRPKLSETFESNGFVSIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGFDHLNVYELQRFDKGKAYEVIHDEKKPICHTKSLTGKMPQLWDWVEKADFVRNFTSSGTLYDLWSYKTAGITLEVGVPQAHPDILAYFGRFSAGNEFSYFVETWKNIKPHSTWFEIPRECHLGPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.