NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026397

3300026397: Metatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.SFe12 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026397 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132855 | Gp0291468 | Ga0247510
Sample NameMetatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.SFe12 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size71041590
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa
TypeEngineered
TaxonomyEngineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: New York
CoordinatesLat. (o)42.4447Long. (o)-76.485Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024821Metagenome / Metatranscriptome204Y
F031111Metagenome / Metatranscriptome183N
F042955Metagenome / Metatranscriptome157Y
F103516Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247510_103690All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes3263Open in IMG/M
Ga0247510_123839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae655Open in IMG/M
Ga0247510_126639All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038594Open in IMG/M
Ga0247510_128302Not Available564Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247510_103690Ga0247510_1036902F031111RTKRVKKVTGMKNQVLFSIFKNKTRRKKEKSRFLIGKKRCISNIPQNSYYQTIVNIPAAYNFCCYYPQNLPSSQIGKQVKKILKPLNLALIKLSKPKLTFP
Ga0247510_123839Ga0247510_1238392F024821MEGSTREKFLHALMQYQEKHGQEKASAIQERFWQQRERVVAESAADIDWFPSWKKNQILESLLEKTYRDLIVE
Ga0247510_126639Ga0247510_1266391F042955GKEAPMNRLARILPVAVAAGVLAWLWYSAWPELFRAGMPSITEDAEFALLVRLTGFVVLLGVAFWFAARNLMKK
Ga0247510_128302Ga0247510_1283021F103516LLAGCGAATNVQVMKPVNGEIQSFLTPELLKSRCYNFMSAGREGEMIAKKSNVLLNECNLTAKDAVNRVTYLTYTTKDAYVAESGENQVISKRVMGNKDIEIESRLFYEKEGGVRGIQVLINDFVDKNYVKGYEPEWVVRALYREVKLQDGKIVVVRDGMTRDEFMKEDEIEHYKKLNRMLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.