NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026396

3300026396: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0912-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026396 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296210 | Ga0256761
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0912-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size83314703
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006133Metagenome / Metatranscriptome380Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256761_1027665All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii811Open in IMG/M
Ga0256761_1035075All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff688Open in IMG/M
Ga0256761_1035084All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff688Open in IMG/M
Ga0256761_1037963All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff653Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256761_1027665Ga0256761_10276651F006133NSVCIVWTIRRLLIDHHWRLSRRCVVMMMKSLSLRPIVLVALLALLASPLLLSLSPASSVLSAAPERKAQDVEDCVACRYIWLQVEMDVGNSQIEENIYDSFTQNCIEAQKAPIFYPACQDMFDGIDDMIGDYMDGYTVNQVCENARLCR
Ga0256761_1035075Ga0256761_10350751F098404HKGAACLSIFRLTHTVMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWFHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEIIHDVKKPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYVEQWKTDKPHSTWFEIPRECHLGSQ
Ga0256761_1035084Ga0256761_10350842F098404LALAIACAAAQQTRPKLSETFESKGFVQIKNNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPNILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPKECHLGPK
Ga0256761_1037963Ga0256761_10379631F098404PAFSLDPQHIMRSALFFVVLAVAIACAAAAVRPKLSETFESNGFVSIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGFDHLNVYELQRFDKGKAYEVIHDEKKPICHTKSLTGKMPQLWDWVEKADFVRNFTSAGTLYDLWSYKTAGITLEVGVPQAHPDILAYFGRFSAGNEFSYFVETWKNIKPHSTWFEIPRECHLGPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.