3300026379: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0916-MT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300026379
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114432 | Gp0296214 | Ga0256765
• Sample Name: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0916-MT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 47570695
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034190	Metagenome / Metatranscriptome	175	Y
F041209	Metagenome / Metatranscriptome	160	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256765_117634	Not Available	755
Ga0256765_119817	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	702

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256765_117634	Ga0256765_1176341	F034190	NAVLGLMSPSATHPCPICIVGKKNLLHSSRYRTAGDRFSLHPSAAALLTIPPERIVPTPLHLFLGISNRIILEVFSELLGKDLVEETLKQATTIHSAGCGGKSDLHDLNGPEIRKWLKKDCCSTLLAAAAARNGSGMAAATRATFSILQRWLQQLHDHLLHKDDWEPEDIEAWRAAVDDIWQNWTAETSQEAFPKLHMLRHSLEFAERHRFLGRASEAQIESFHYEFKRLYHQQHLNMAHNEPERLRRCLA
Ga0256765_119817	Ga0256765_1198171	F041209	LSAAPSHTIVLPGEQAYVLATETSAYAKRYDMIAVCAGDRVLLPKIFSPKERAGAEVKGINRSMLLQFIDDVLAQAVEGLDRYPLTLVLDRATIHMDLDAIRQAFRDRGSEAISDILLMPPNAAKRLSPLDNSLFHDWKEECRRHCPATAKTIERIMSDAWEKLKPGPHYLHCGLTRSKDVYFDCPAPAKHKHAS