3300026249: Upper troposphere microbial communities - SDPR-005 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026249
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110167 | Gp0085230 | Ga0209549
• Sample Name: Upper troposphere microbial communities - SDPR-005 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 63064179
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
• Type: Environmental
• Taxonomy: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Aerosol (non-saline)

Location Information

• Location: USA and various oceans
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027181	Metagenome / Metatranscriptome	195	Y
F036741	Metagenome	169	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209549_1009537	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	557
Ga0209549_1009925	Not Available	546

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209549_1009537	Ga0209549_10095371	F027181	PPKLYEVTLSSGTMHLLAPDSESAAWMALELSHERDDKLVNVRQADEW
Ga0209549_1009925	Ga0209549_10099251	F036741	MNHKEFFKILVGNPPPEIEFEIEVKQRETEQMPDEAVRAYCLDLVKYTRLQDLLLSSAITRISDIETKLMRYEKGMRLYKKVRKLGFFGKIKYLLSG