3300026219: Upper troposphere microbial communities from Maryland, USA - DAQMD-015 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026219
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110167 | Gp0085189 | Ga0209242
• Sample Name: Upper troposphere microbial communities from Maryland, USA - DAQMD-015 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55041762
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
• Type: Environmental
• Taxonomy: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Aerosol (non-saline)

Location Information

• Location: USA: Maryland, Virginia
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024268	Metagenome / Metatranscriptome	206	Y
F043390	Metagenome / Metatranscriptome	156	N
F074867	Metagenome / Metatranscriptome	119	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209242_1005966	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium	566
Ga0209242_1006009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae	563
Ga0209242_1006967	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae	509

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209242_1005966	Ga0209242_10059661	F043390	DLQKVIILTLTAEQLETIAGALEMYCIGLAEHNDPHLKYAADAQEAIIDVLEDNFSVEE
Ga0209242_1006009	Ga0209242_10060092	F024268	MITEFFANSEAVGSTEWSLTTDTAGPDVEVTKGCFQIFLDISDMIAGDELEIKIYEKVQSSDTQRVIYQSNLIGPQSPAVWVSPSLILLNGWDVTLKTIAGGTITVSW
Ga0209242_1006967	Ga0209242_10069672	F074867	MSSRGITDIILNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKTGDVVSIIQVCAVPANSRKFPSWWTRDGVGEAVISAGLVGITTSVTHFLAKALTAGTETDIKTVGSESDE