| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025607 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118071 | Gp0127829 | Ga0209291 |
| Sample Name | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM9B Gulf of Mexico (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 408950416 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine cold seep biome → mesocosm → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 27.37 | Long. (o) | -90.57 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006552 | Metagenome | 370 | Y |
| F062844 | Metagenome | 130 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209291_1057609 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1130 | Open in IMG/M |
| Ga0209291_1059689 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1100 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209291_1057609 | Ga0209291_10576093 | F062844 | LCAEAANGKVATAATSAKSRMVFLVMIFDFALKVFS |
| Ga0209291_1059689 | Ga0209291_10596891 | F006552 | PNVEIPLLISPVLKIKSSRINPVANIPKPIPIAKKAIDNLNNVGLAVFLNPIYEIVPITRPTKSPTRLRIISKKNSNYADSVTVLNKV |
| ⦗Top⦘ |